Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGRP, Human (HEK293, His)

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AGRP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/agrp-protein-human-hek293-his.html

Purity

95.00

Smiles

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Molecular Formula

181 (Gene_ID) O00253 (A21-T132) (Accession)

Molecular Weight

Approximately 16-21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HORMAD1 (HORMA Domain-containing Protein 1, Cancer/Testis Antigen 46, CT46, Newborn Ovary HORMA Protein, NOHMA, DKFZp434A1315, NOHMA, RP11-363I22.1) APC
MBS6137019-01 0.1 mL

HORMAD1 (HORMA Domain-containing Protein 1, Cancer/Testis Antigen 46, CT46, Newborn Ovary HORMA Protein, NOHMA, DKFZp434A1315, NOHMA, RP11-363I22.1) APC

Sign In for Pricing
View Details
HORMAD1 (HORMA Domain-containing Protein 1, Cancer/Testis Antigen 46, CT46, Newborn Ovary HORMA Protein, NOHMA, DKFZp434A1315, NOHMA, RP11-363I22.1) APC
MBS6137019-02 5x 0.1 mL

HORMAD1 (HORMA Domain-containing Protein 1, Cancer/Testis Antigen 46, CT46, Newborn Ovary HORMA Protein, NOHMA, DKFZp434A1315, NOHMA, RP11-363I22.1) APC

Sign In for Pricing
View Details
Mycoplasma detection kit
E28XB0087 50 Tests

Mycoplasma detection kit

Sign In for Pricing
View Details
MMAB Mouse Monoclonal Antibody [Clone ID: OTI4D12]
CF502166 100 µg

MMAB Mouse Monoclonal Antibody [Clone ID: OTI4D12]

Sign In for Pricing
View Details
RANBP20P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1784306 1.0 µg DNA

RANBP20P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CEF6
TP1822-01 1 mg

CEF6

Sign In for Pricing
View Details