Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse (solution)

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse (solution) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse (solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse.html

Purity

95.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742 (M1-L164) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Claudin 8 (CLDN8) ELISA Kit
201-10-2218 96 Tests

Porcine Claudin 8 (CLDN8) ELISA Kit

Sign In for Pricing
View Details
Rat Fer ELISA Kit
EF018681 96 Tests

Rat Fer ELISA Kit

Sign In for Pricing
View Details
Perilipin A Rabbit mAb
AB102531 100 µL

Perilipin A Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human PGAM1 Protein
NBP2-52620 100 µg

Recombinant Human PGAM1 Protein

Sign In for Pricing
View Details
UBF1 (UBTF) (NM_001076683) Human Tagged Lenti ORF Clone
RC208047L4 10 µg

UBF1 (UBTF) (NM_001076683) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TP53I11 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV697500 1.0 µg DNA

TP53I11 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details