Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse (solution)

Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse (solution) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse (solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse.html

Purity

95.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742 (M1-L164) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAI7 Human Gene Knockout Kit (CRISPR)
KN406207 1 Kit

DNAI7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WDR5 ligand 2
orb2944775-01 50 mg

WDR5 ligand 2

Sign In for Pricing
View Details
WDR5 ligand 2
orb2944775-02 10 mg

WDR5 ligand 2

Sign In for Pricing
View Details
C-Myc (human) Recombinant monoclonal antibody (9E10) (Rat IgG2cκ)
ENZ-ABS472-0200 200 µg

C-Myc (human) Recombinant monoclonal antibody (9E10) (Rat IgG2cκ)

Sign In for Pricing
View Details
TBC1D14 (NM_001113363) Human Tagged ORF Clone
RC225650 10 µg

TBC1D14 (NM_001113363) Human Tagged ORF Clone

Sign In for Pricing
View Details
3-ethyl-2-methylbenzaldehyde
OR1082090-01 250 mg

3-ethyl-2-methylbenzaldehyde

Sign In for Pricing
View Details