Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html

Purity

97.00

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

15-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDYE1 Antibody - C-terminal region
MBS3213594-01 0.1 mL

SPDYE1 Antibody - C-terminal region

Sign In for Pricing
View Details
SPDYE1 Antibody - C-terminal region
MBS3213594-02 5x 0.1 mL

SPDYE1 Antibody - C-terminal region

Sign In for Pricing
View Details
LOC143920 Human shRNA Plasmid Kit (Locus ID 143920)
TR317906 1 Kit

LOC143920 Human shRNA Plasmid Kit (Locus ID 143920)

Sign In for Pricing
View Details
Kinetochore (KNTC1) Rabbit Polyclonal Antibody
TA377885 100 µL

Kinetochore (KNTC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C11orf58 Protein Vector (Human) (pPM-N-D-C-His)
PV328385 500 ng

C11orf58 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS702742 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details