Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html

Purity

97.00

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

15-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indole
TRC-I577320-25G 25 g

Indole

Sign In for Pricing
View Details
Human MCM3 Protein Lysate
MBS8415057-01 0.02 mg

Human MCM3 Protein Lysate

Sign In for Pricing
View Details
Human MCM3 Protein Lysate
MBS8415057-02 5x 0.02 mg

Human MCM3 Protein Lysate

Sign In for Pricing
View Details
MAGT1 Protein Vector (Mouse) (pPB-C-His)
PV198750 500 ng

MAGT1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat Caspase 11 ELISA Kit
MBS008490-01 48 Well

Rat Caspase 11 ELISA Kit

Sign In for Pricing
View Details
Rat Caspase 11 ELISA Kit
MBS008490-02 96 Well

Rat Caspase 11 ELISA Kit

Sign In for Pricing
View Details