Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html

Purity

97.00

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

15-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCSK5 antibody
STJ71709 100 µg

Anti-PCSK5 antibody

Sign In for Pricing
View Details
RAD17 Protein Lysate (Mouse) with C-HA Tag
38407035 100 µg

RAD17 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-C12orf54 antibody
PAab01013 100 µg

Anti-C12orf54 antibody

Sign In for Pricing
View Details
Cyclin D2 (CCND2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G9]
TA806254BM 100 µL

Cyclin D2 (CCND2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G9]

Sign In for Pricing
View Details
CHO Monoclonal beta Amyloid Antibody (U.Illinois scFv59) - (Dry Ice)
NBP3-28660-50ug 50 µg

CHO Monoclonal beta Amyloid Antibody (U.Illinois scFv59) - (Dry Ice)

Sign In for Pricing
View Details
Anti-NR2E1 antibody
STJ115324 100 µl

Anti-NR2E1 antibody

Sign In for Pricing
View Details