Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html

Purity

97.00

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

15-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat KCND3 Protein, His (Fc)-Avi-tagged
KCND3-2832R 50 µg

Recombinant Rat KCND3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Aldh1l1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4689602 1.0 µg DNA

Aldh1l1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal SMPD1 Antibody (09) [Alexa Fluor 594]
NBP3-06597AF594 0.1 mL

Mouse Monoclonal SMPD1 Antibody (09) [Alexa Fluor 594]

Sign In for Pricing
View Details
BACE2 (Isoform C) (C-term) Rabbit Polyclonal Antibody
AP13070PU-N 400 µL

BACE2 (Isoform C) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CysLT1 (CYSLTR1) (NM_006639) Human Tagged ORF Clone Lentiviral Particle
RC207763L1V 200 µL

CysLT1 (CYSLTR1) (NM_006639) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TBC1D26 (NM_178571) Human Tagged ORF Clone Lentiviral Particle
RC208210L4V 200 µL

TBC1D26 (NM_178571) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details