Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html

Purity

97.00

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

15-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPP14 siRNA (Human)
CRH7594-01 15 nmol

RPP14 siRNA (Human)

Sign In for Pricing
View Details
RPP14 siRNA (Human)
CRH7594-02 30 nmol

RPP14 siRNA (Human)

Sign In for Pricing
View Details
Rabbit anti-human calpain 1(CAPN1) polyclonal Antibody
MBS712441-01 0.1 mL

Rabbit anti-human calpain 1(CAPN1) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human calpain 1(CAPN1) polyclonal Antibody
MBS712441-02 5x 0.1 mL

Rabbit anti-human calpain 1(CAPN1) polyclonal Antibody

Sign In for Pricing
View Details
Bent Cryo Tong
JBS-X-CC-112 1 Each

Bent Cryo Tong

Sign In for Pricing
View Details
Htatsf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3741908 1.0 µg DNA

Htatsf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details