CD59, Human (HEK293, His)
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD59 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html
Purity
97.00
Smiles
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Molecular Formula
966 (Gene_ID) P13987-1 (L26-N102) (Accession)
Molecular Weight
15-20 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S; N501Y, P681H), partial
Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S; N501Y, P681H), partial
Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S; N501Y, P681H), partial
