Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Human (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-human-hek-293-his.html

Purity

97.00

Smiles

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Molecular Formula

966 (Gene_ID) P13987-1 (L26-N102) (Accession)

Molecular Weight

15-20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-500 1x 500 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF594 conjugate, 0.1mg/mL
BNC942397-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF488A conjugate, 0.1mg/mL
BNC880859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL
BNC880532-100 1x 100 µL

Cytokeratin 14 (KRT14/532), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details