Recombinant Human parainfluenza 1 virus Nucleoprotein (N)

MAGLLSTFDTFSSRRSESINKSGGGAIIPGQRSTVSVFILGPSVTDDADKLLIATTFLAHSLDTDKQHSQRGGFLVSLLAMAYSSPELYLTTNGVNADVKYVIYNIERDPKRTKTDGFIVKTRDMEYERTTEWLFGPMINKNPLFQGQRENADLEALLQTYGYPACLGAIIVQVWIVLVKAITSSSGLRKGFFNRLEAFRQDGTVKSALVFTGDTVEGIGAVMRSQQSLVSLMVETLVTMNTSRSDLTTLEKNIQIVGNYIRESGLASFMNTIKYGVETKMAALTLSNLRPDINKLRSLVDIYLSKGARAPFTCILRDPVHGEFAPGNYPALWSYAMGVAVVQNKAMQQYVTGRTYLDMEMFLLGQAVAKDADSKISSALEEELGVTDTAKERLRHHLTNLSGGDGAYHKPTGGGAIEVAIDHTDITFGAEDTADRDNKNWTNNSNERWMNHSINNHTITISGAEELEEETNDEDITDIENKIARRLADRKQRLSQANNRQDASSDADHENDDDATAAAGIGGI

Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity).

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.