Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXADR, Mouse (HEK293, Fc)

CXADR protein is a key component of the epithelial apical junction complex, which maintains the integrity of tight junctions and enables leukocyte migration through adhesive interactions with JAML. This interaction activates γ-δ T cells and promotes tissue repair through cell signaling involving PI3 kinase and MAP kinase. CXADR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CXADR protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CXADR Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxadr-protein-mouse-hek-293-fc.html

Purity

96.49

Smiles

LSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAG

Molecular Formula

13052 (Gene_ID) P97792 (L20-G237) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSHB Antibody, Biotin conjugated
CSB-PA12335D0Rb-01 50 µg

FSHB Antibody, Biotin conjugated

Sign In for Pricing
View Details
FSHB Antibody, Biotin conjugated
CSB-PA12335D0Rb-02 100 µg

FSHB Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Ubiquitin Carboxyl-Terminal Hydrolase 26 (USP26) ELISA Kit
abx552308 96 Tests

Mouse Ubiquitin Carboxyl-Terminal Hydrolase 26 (USP26) ELISA Kit

Sign In for Pricing
View Details
Rat IgG2B Alexa Fluor 405 Isotype Control (Clone 141945)
IC013V 200 Tests

Rat IgG2B Alexa Fluor 405 Isotype Control (Clone 141945)

Sign In for Pricing
View Details
Acp6 Mouse shRNA Lentiviral Particle (Locus ID 66659)
TL512892V 500 µL Each

Acp6 Mouse shRNA Lentiviral Particle (Locus ID 66659)

Sign In for Pricing
View Details
RAE1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3791R-BF680 100 µL

RAE1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details