Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Formula

21667 (Gene_ID) P51865 (R26-Q150) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX12 antibody
70R-20772 50 ul

TEX12 antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (SULT1E1/7124)
NBP3-26733-100ug 100 µg

Mouse Monoclonal Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (SULT1E1/7124)

Sign In for Pricing
View Details
PAICS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1589107 1.0 µg DNA

PAICS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Oenothera biennis Photosystem Q (B) protein, partial
MBS7071220 Inquire

Recombinant Oenothera biennis Photosystem Q (B) protein, partial

Sign In for Pricing
View Details
Cytokeratin 75 Blocking Peptide
33R-6488 100 ug

Cytokeratin 75 Blocking Peptide

Sign In for Pricing
View Details
CA10 Rabbit pAb
E47R6024 100 µL

CA10 Rabbit pAb

Sign In for Pricing
View Details