Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Formula

21667 (Gene_ID) P51865 (R26-Q150) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNG4 Rabbit Polyclonal Antibody
TA351317 100 µL

KCNG4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ATP synthase delta chain Polyclonal Antibody
AB3E071 0.1mg

Anti-ATP synthase delta chain Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A40 CRISPR/Cas9 KO Plasmid (m)
sc-435651 20 µg

SLC25A40 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
SDR42E1 Protein Vector (Human) (pPB-N-His)
PV037154 500 ng

SDR42E1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
NRBF-2 Polyclonal Antibody
ABP51985-01 30 µL

NRBF-2 Polyclonal Antibody

Sign In for Pricing
View Details
NRBF-2 Polyclonal Antibody
ABP51985-02 100 µL

NRBF-2 Polyclonal Antibody

Sign In for Pricing
View Details