Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Formula

21667 (Gene_ID) P51865 (R26-Q150) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ROR gamma/RORC/NR1F3 Antibody (RORC/8278R) [DyLight 550]
NBP3-27002R 0.1 mL

Rabbit Monoclonal ROR gamma/RORC/NR1F3 Antibody (RORC/8278R) [DyLight 550]

Sign In for Pricing
View Details
Poliovirus 3 Real Time RT‐PCR Kit
PDPS-AR081 25 Tests

Poliovirus 3 Real Time RT‐PCR Kit

Sign In for Pricing
View Details
Acin1 3'UTR Luciferase Stable Cell Line
TU101259 1.0 mL

Acin1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human FGF12 Recombinant Protein
PPT-12672 100 µg

Human FGF12 Recombinant Protein

Sign In for Pricing
View Details
RAB18 Protein Lysate (Rat) with C-HA Tag
38303036 100 µg

RAB18 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP76C3 Polyclonal Antibody
MBS7182340 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP76C3 Polyclonal Antibody

Sign In for Pricing
View Details