Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Formula

21667 (Gene_ID) P51865 (R26-Q150) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pecam1 Recombinant Antibody
RAC07916-01 50 µL

Pecam1 Recombinant Antibody

Sign In for Pricing
View Details
Pecam1 Recombinant Antibody
RAC07916-02 100 µL

Pecam1 Recombinant Antibody

Sign In for Pricing
View Details
RORA Knockout Cell Line-HEK293
RK-0962 1x 10^6

RORA Knockout Cell Line-HEK293

Sign In for Pricing
View Details
Recombinant Mouse Sentrin-specific protease 1 (Senp1)
MBS951554-01 0.02 mg (E-Coli)

Recombinant Mouse Sentrin-specific protease 1 (Senp1)

Sign In for Pricing
View Details
Recombinant Mouse Sentrin-specific protease 1 (Senp1)
MBS951554-02 0.02 mg (Yeast)

Recombinant Mouse Sentrin-specific protease 1 (Senp1)

Sign In for Pricing
View Details
Recombinant Mouse Sentrin-specific protease 1 (Senp1)
MBS951554-03 0.1 mg (E-Coli)

Recombinant Mouse Sentrin-specific protease 1 (Senp1)

Sign In for Pricing
View Details