Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Formula

21667 (Gene_ID) P51865 (R26-Q150) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmtr1 (NM_001014031) Rat Tagged Lenti ORF Clone
RR201349L3 10 µg

Cmtr1 (NM_001014031) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri CCMD Polyclonal Antibody
MBS7165754 Inquire

Rabbit anti-Shigella flexneri CCMD Polyclonal Antibody

Sign In for Pricing
View Details
anti-MCCC1
YF-PA20071 50 ug

anti-MCCC1

Sign In for Pricing
View Details
Iminodiacetic Acid
40000029-1 25 g

Iminodiacetic Acid

Sign In for Pricing
View Details
Anti-WDR26 Rabbit pAb
GB113178-50 50 μL

Anti-WDR26 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human PSKH2 shRNA (UAS) - Lentiviral human PSKH2 shRNA (UAS, iRFP) plasmid
GTR15109852 1 Vial

Lentiviral human PSKH2 shRNA (UAS) - Lentiviral human PSKH2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details