Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Molecular Formula

21667 (Gene_ID) P51865 (R26-Q150) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD168/RHAMM Rabbit Monoclonal Antibody
AG2177 50 µL

CD168/RHAMM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SK3 (SKCa3, KCNN3, K Ca 2.3, Small Conductance Ca2+-activated Potassium Channel 3) (MaxLight 750) discontinued
S1014-09N-ML750 100 µL

SK3 (SKCa3, KCNN3, K Ca 2.3, Small Conductance Ca2+-activated Potassium Channel 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit anti-SMARCB1/SNF5 Recombinant Monoclonal Antibody [BLR305M)
A700-305 100 µL (10 Blots)

Rabbit anti-SMARCB1/SNF5 Recombinant Monoclonal Antibody [BLR305M)

Sign In for Pricing
View Details
Lentiviral human LYPD8 shRNA (UAS) - Lentiviral human LYPD8 shRNA (UAS, GFP) (25)
GTR15102896 1 Vial

Lentiviral human LYPD8 shRNA (UAS) - Lentiviral human LYPD8 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SYP Monoclonal Antibody
BT-MCA1179-01 50 µL

SYP Monoclonal Antibody

Sign In for Pricing
View Details
SYP Monoclonal Antibody
BT-MCA1179-02 100 µL

SYP Monoclonal Antibody

Sign In for Pricing
View Details