DNASE1L3, Human (His)
DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (His) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with C-10*His labeled tag.
Product Specifications
Product Name Alternative
DNASE1L3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/dnase1l3-protein-human-his.html
Purity
95
Smiles
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Molecular Formula
1776 (Gene_ID) Q13609 (M21-S305) (Accession)
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details