Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-mouse-hek293-mfc.html

Purity

95.0

Smiles

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Formula

100043314 (Gene_ID) NP_001139797 (A17-G141) (Accession)

Molecular Weight

Approximately 39-52 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARG (ARHGEF12) Human Gene Knockout Kit (CRISPR)
KN424785 1 Kit

LARG (ARHGEF12) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OGFRL1 activation kit by CRISPRa
GA112499 1 Kit

Human OGFRL1 activation kit by CRISPRa

Sign In for Pricing
View Details
PPP1R3G (NM_001145115) Human Over-expression Lysate
LC428701 20 µg

PPP1R3G (NM_001145115) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF405S conjugate, 0.1mg/mL
BNC042859-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glutathione Transferase zeta 1 (GSTZ1) Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF810615 100 µg

Glutathione Transferase zeta 1 (GSTZ1) Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (N/A), 0.2mg/mL
BNUB1800-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (N/A), 0.2mg/mL

Sign In for Pricing
View Details