Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-mouse-hek293-mfc.html

Purity

95.0

Smiles

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Formula

100043314 (Gene_ID) NP_001139797 (A17-G141) (Accession)

Molecular Weight

Approximately 39-52 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ASNSD1 activation kit by CRISPRa
GA110157 1 Kit

Human ASNSD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Zswim1 Mouse Gene Knockout Kit (CRISPR)
KN520162 1 Kit

Zswim1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse TYRO3/DTK Protein (mFc Tag)
PKSM041179-01 10 µg

Recombinant Mouse TYRO3/DTK Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Mouse TYRO3/DTK Protein (mFc Tag)
PKSM041179-02 50 µg

Recombinant Mouse TYRO3/DTK Protein (mFc Tag)

Sign In for Pricing
View Details
Integrin β4 (Ab-1510) Antibody
8B1078-AAT 50 µg

Integrin β4 (Ab-1510) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS625625 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details