Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-mouse-hek293-mfc.html

Purity

95.0

Smiles

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Formula

100043314 (Gene_ID) NP_001139797 (A17-G141) (Accession)

Molecular Weight

Approximately 39-52 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP7 Recombinant Rabbit Monoclonal Antibody [JB80-36]
ET7107-53 100 µL

USP7 Recombinant Rabbit Monoclonal Antibody [JB80-36]

Sign In for Pricing
View Details
RNF149 Mouse Monoclonal Antibody [Clone ID: OTI12C2]
CF810551 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI12C2]

Sign In for Pricing
View Details
KIF3B Rabbit Polyclonal Antibody
AP42244PU-N 100 µL

KIF3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Radicicol
SIH-117A 1 mg

Radicicol

Sign In for Pricing
View Details
TAF1 Human Gene Knockout Kit (CRISPR)
KN416684 1 Kit

TAF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diflubenzuron-d4 (4-chlorophenyl-d4)
TRC-D445521-5MG 5 mg

Diflubenzuron-d4 (4-chlorophenyl-d4)

Sign In for Pricing
View Details