Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-mouse-hek293-mfc.html

Purity

95.0

Smiles

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Formula

100043314 (Gene_ID) NP_001139797 (A17-G141) (Accession)

Molecular Weight

Approximately 39-52 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Aminopentan-2-ol
TRC-A226241-100MG 100 mg

3-Aminopentan-2-ol

Sign In for Pricing
View Details
alpha 1 Fetoprotein (AFP) (N-term) Rabbit Polyclonal Antibody
AP11397PU-N 400 µL

alpha 1 Fetoprotein (AFP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Synaptojanin (SYNJ1) (NM_001160302) Human Over-expression Lysate
LY431693 100 µg

Synaptojanin (SYNJ1) (NM_001160302) Human Over-expression Lysate

Sign In for Pricing
View Details
SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI8H2]
CF806440 100 µg

SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI8H2]

Sign In for Pricing
View Details
Adcy5 Mouse Gene Knockout Kit (CRISPR)
KN500891 1 Kit

Adcy5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Mouse CD132 Antibody
RD20287F-01 25 µg

Purified Anti-Mouse CD132 Antibody

Sign In for Pricing
View Details