Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-mouse-hek293-mfc.html

Purity

95.0

Smiles

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Formula

100043314 (Gene_ID) NP_001139797 (A17-G141) (Accession)

Molecular Weight

Approximately 39-52 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (POMC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]
TA506608AM 100 µL

ACTH (POMC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
3-Amino-2-chloro-propenal
TRC-A604190-10MG 10 mg

3-Amino-2-chloro-propenal

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS716821 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
Psmd2 Mouse Gene Knockout Kit (CRISPR)
KN514121 1 Kit

Psmd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Angiotensin II Type 2 Receptor (AGTR2) (NM_000686) Human Over-expression Lysate
LC400227 20 µg

Angiotensin II Type 2 Receptor (AGTR2) (NM_000686) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS706725 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details