Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Mouse (HEK293, mFc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Mouse (HEK293, mFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-mouse-hek293-mfc.html

Purity

95.0

Smiles

AFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG

Molecular Formula

100043314 (Gene_ID) NP_001139797 (A17-G141) (Accession)

Molecular Weight

Approximately 39-52 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kB p65 Recombinant Rabbit monoclonal Antibody
HA750601 100 µL

NF-kB p65 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DDX4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F11]
TA813369BM 100 µL

DDX4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F11]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803Q-01 25 µg

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803Q-02 100 µg

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) pSer49 Rabbit Polyclonal Antibody
AP08033PU-N 100 µL

elF2 alpha (EIF2S1) pSer49 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1368-01 50 μL

RAD51 Antibody

Sign In for Pricing
View Details