Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smg6 siRNA Oligos set (Mouse)
44450174 3x 5 nmol

Smg6 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
NUAK1 Knockout T47D Polyclonal Cells
ARG12027 1 Million

NUAK1 Knockout T47D Polyclonal Cells

Sign In for Pricing
View Details
Slc25a26 (NM_001108638) Rat Untagged Clone
RN203286 10 µg

Slc25a26 (NM_001108638) Rat Untagged Clone

Sign In for Pricing
View Details
Drug Resistance Gene Panel
PH2008550-01 4 Reactions

Drug Resistance Gene Panel

Sign In for Pricing
View Details
Drug Resistance Gene Panel
PH2008550-02 4 Reactions

Drug Resistance Gene Panel

Sign In for Pricing
View Details
Human Peptide YY ELISA Kit (Colorimetric)
NBP2-62166 1 Kit

Human Peptide YY ELISA Kit (Colorimetric)

Sign In for Pricing
View Details