Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5031410I06Rik (NM_207657) Mouse Tagged Lenti ORF Clone
MR213499L3 10 µg

5031410I06Rik (NM_207657) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NOX1 siRNA (Human)
CRH8933-01 15 nmol

NOX1 siRNA (Human)

Sign In for Pricing
View Details
NOX1 siRNA (Human)
CRH8933-02 30 nmol

NOX1 siRNA (Human)

Sign In for Pricing
View Details
GENLISA™ Human Lymphocyte Antigen 6 Complex locus Protein G6d (LY6G6D) ELISA
KBH5607 1x 96 Well

GENLISA™ Human Lymphocyte Antigen 6 Complex locus Protein G6d (LY6G6D) ELISA

Sign In for Pricing
View Details
OXCT2P AAV siRNA Pooled Vector
63394161 1.0 µg

OXCT2P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human TNNC1&TNNI3 protein, C-His Tag
MBS157428-01 0.05 mg

Recombinant Human TNNC1&TNNI3 protein, C-His Tag

Sign In for Pricing
View Details