Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDA5 CRISPR Activation Plasmid (h)
sc-401962-ACT 20 µg

MDA5 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
EDA2R Human shRNA Plasmid Kit (Locus ID 60401)
TR304853 1 Kit

EDA2R Human shRNA Plasmid Kit (Locus ID 60401)

Sign In for Pricing
View Details
TCP1P2 3'UTR Luciferase Stable Cell Line
TU025344 1.0 mL

TCP1P2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GMP Recombinant Human IL-2
PCH90024 50 µg

GMP Recombinant Human IL-2

Sign In for Pricing
View Details
Tenascin-C shRNA Plasmid (h)
sc-43186-SH 20 µg

Tenascin-C shRNA Plasmid (h)

Sign In for Pricing
View Details
DDB1 polyclonal antibody
BS78489-01 50 µL

DDB1 polyclonal antibody

Sign In for Pricing
View Details