Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Paired mesoderm homeobox protein 2, PRRX2 ELISA KIT
ELI-36245h 96 Tests

Human Paired mesoderm homeobox protein 2, PRRX2 ELISA KIT

Sign In for Pricing
View Details
Intein
pro-958 5µg

Intein

Sign In for Pricing
View Details
Alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: LBI1B3]
AMM10671V 100 µL

Alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: LBI1B3]

Sign In for Pricing
View Details
PCMV-CTCF-3xFLAG-Neo Plasmid
PVT74602 2 µg

PCMV-CTCF-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Vanadium Wire 1.0 mm diameter, 99.8% annealed
GX8439-1m 1 m

Vanadium Wire 1.0 mm diameter, 99.8% annealed

Sign In for Pricing
View Details
PAAF1, NT (PAAF1, WDR71, Proteasomal ATPase-associated factor 1, Protein G-16, WD repeat-containing protein 71) (Biotin) discontinued
039598-Biotin 200 µL

PAAF1, NT (PAAF1, WDR71, Proteasomal ATPase-associated factor 1, Protein G-16, WD repeat-containing protein 71) (Biotin) discontinued

Sign In for Pricing
View Details