Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSIG4 (NM_001257403) Human Tagged ORF Clone
RC232543 10 µg

VSIG4 (NM_001257403) Human Tagged ORF Clone

Sign In for Pricing
View Details
KIAA1239 (NWD2) (NM_001144990) Human Over-expression Lysate
LS057495-20ug 20 µg

KIAA1239 (NWD2) (NM_001144990) Human Over-expression Lysate

Sign In for Pricing
View Details
CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (MaxLight 490)
244209-ML490 100 µL

CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (MaxLight 490)

Sign In for Pricing
View Details
GCN5L2, 411-837aa, Human, His tag, E.coli
E53A02213 50 µg

GCN5L2, 411-837aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Recombinant Human PASK Protein, His (Fc)-Avi-tagged
PASK-1610H 50 µg

Recombinant Human PASK Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Inhibin β-E Rabbit mAb
E60M1011 100 µL

Inhibin β-E Rabbit mAb

Sign In for Pricing
View Details