Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (Biotinylated, HEK293, Avi)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with C-Avi labeled tag.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (Biotinylated, HEK293, Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-human-hek-293-avi.html

Purity

95.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OBP2A Protein Lysate
MBS8416405-01 0.02 mg

Human OBP2A Protein Lysate

Sign In for Pricing
View Details
Human OBP2A Protein Lysate
MBS8416405-02 5x 0.02 mg

Human OBP2A Protein Lysate

Sign In for Pricing
View Details
Wdr62 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50354116 3x 1.0 µg

Wdr62 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
1110059G10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3510006 1.0 µg DNA

1110059G10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
IL12B Protein Vector (Rat) (pPM-C-His)
PV274333 500 ng

IL12B Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GHDC sgRNA CRISPR Lentivector (Human) (Target 1)
K0856202 1.0 µg DNA

GHDC sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details