Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Relaxin receptor 2 (RXFP2), partial

Product Specifications

Product Name Alternative

(G-protein coupled receptor 106) (G-protein coupled receptor affecting testicular descent) (Leucine-rich repeat-containing G-protein coupled receptor 8) (Relaxin family peptide receptor 2)

Abbreviation

Recombinant Human RXFP2 protein, partial

Gene Name

RXFP2

UniProt

Q8WXD0

Expression Region

33-158aa

Organism

Homo sapiens (Human)

Target Sequence

FALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

References & Citations

"Activation of orphan receptors by the hormone relaxin." Hsu S.Y., Nakabayashi K., Nishi S., Kumagai J., Kudo M., Sherwood O.D., Hsueh A.J.W. Science 295:671-674 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P70 S6 kinase α, phosphorylated (T412) discontinued
341282-01 100 µL

P70 S6 kinase α, phosphorylated (T412) discontinued

Sign In for Pricing
View Details
P70 S6 kinase α, phosphorylated (T412) discontinued
341282-02 200 µL

P70 S6 kinase α, phosphorylated (T412) discontinued

Sign In for Pricing
View Details
Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)
abx305986-01 20 µg

Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)
abx305986-02 50 µg

Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)
abx305986-03 100 µg

Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)
abx305986-04 200 µg

Zinc Finger Protein 165 (ZNF165) Antibody (Biotin)

Sign In for Pricing
View Details