Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM, Human (HEK293, His)

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HEPACAM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hepacam-protein-human-hek-293-his.html

Purity

95.0

Smiles

VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSS

Molecular Formula

220296 (Gene_ID) Q14CZ8-1/NP_689935.2 (V34-S240) (Accession)

Molecular Weight

35-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TUBG1 Antibody
RC-5722-01 50 μL

Recombinant TUBG1 Antibody

Sign In for Pricing
View Details
Recombinant TUBG1 Antibody
RC-5722-02 100 µL

Recombinant TUBG1 Antibody

Sign In for Pricing
View Details
Recombinant TUBG1 Antibody
RC-5722-03 1 mL

Recombinant TUBG1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS805520 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
FAM55C (NXPE3) (NM_001134456) Human Over-expression Lysate
LC427447 20 µg

FAM55C (NXPE3) (NM_001134456) Human Over-expression Lysate

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY2870R), CF647 conjugate, 0.1mg/mL
BNC472870-100 1x 100 µL

Phosphotyrosine (P-Tyr) (PY2870R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details