Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM, Human (HEK293, His)

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HEPACAM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hepacam-protein-human-hek-293-his.html

Purity

95.0

Smiles

VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSS

Molecular Formula

220296 (Gene_ID) Q14CZ8-1/NP_689935.2 (V34-S240) (Accession)

Molecular Weight

35-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclohexene
TRC-C987513-1ML 1 mL

Cyclohexene

Sign In for Pricing
View Details
RPLP2 Rabbit Polyclonal Antibody
TA369328 100 µL

RPLP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-17562-01 50 μL

MNDA Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-17562-02 100 µL

MNDA Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-17562-03 1 mL

MNDA Antibody

Sign In for Pricing
View Details
THG1L Human Gene Knockout Kit (CRISPR)
KN202845 1 Kit

THG1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details