Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4A3, Rat (HEK293, His)

CLEC4A3 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4A3 protein, expressed by HEK293, with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC4A3 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4a3-protein-rat-hek293-his.html

Purity

96.00

Smiles

LFKKYSQLLEEKTIMKELNYTELECTKWDSLLEDKVWSCCPKDWKPFDSNCYFPSTDSVESWMESEEKCSGIGAHLVVIHSQEEQDFLPRILDTHAAYFIGLSDPGHRQWQWVDQTPYNGNATFWHEGEPSSDNEQCVIINHHENTGWGWSDSSCSDKQKLVCQVKKIYL

Molecular Formula

362431 (Gene_ID) Q5YIS0 (L68-L237) (Accession)

Molecular Weight

Approximately 25-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
BNC940031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF488A conjugate, 0.1mg/mL
BNC881836-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF405S conjugate, 0.1mg/mL
BNC040845-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (K8.8 + DC10), CF594 conjugate, 0.1mg/mL
BNC940691-100 1x 100 µL

Cytokeratin 8/18 (K8.8 + DC10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details