Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Mouse

FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.

Product Specifications

Product Name Alternative

FGF-18 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-mouse.html

Purity

95.0

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG

Molecular Formula

14172 (Gene_ID) O89101 (E28-G207) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]Ellsworth JL, et al. Fibroblast growth factor-18 is a trophic factor for mature chondrocytes and their progenitors. Osteoarthritis Cartilage. 2002 Apr;10 (4) :308-20.|[2]Moore EE, et al. Fibroblast growth factor-18 stimulates chondrogenesis and cartilage repair in a rat model of injury-induced osteoarthritis. Osteoarthritis Cartilage. 2005 Jul;13 (7) :623-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-Fc)
PKSM041435-01 10 µg

Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-Fc)
PKSM041435-02 50 µg

Recombinant Mouse IL-2 Receptor Subunit Beta/IL-2RB/CD122 (C-Fc)

Sign In for Pricing
View Details
Clusterin Antibody
KC-1410-01 50 μL

Clusterin Antibody

Sign In for Pricing
View Details
Clusterin Antibody
KC-1410-02 100 µL

Clusterin Antibody

Sign In for Pricing
View Details
Clusterin Antibody
KC-1410-03 1 mL

Clusterin Antibody

Sign In for Pricing
View Details
PHF19 (NM_001286843) Human Tagged ORF Clone
RG235893 10 µg

PHF19 (NM_001286843) Human Tagged ORF Clone

Sign In for Pricing
View Details