Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Mouse

FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.

Product Specifications

Product Name Alternative

FGF-18 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-mouse.html

Purity

95.0

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG

Molecular Formula

14172 (Gene_ID) O89101 (E28-G207) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]Ellsworth JL, et al. Fibroblast growth factor-18 is a trophic factor for mature chondrocytes and their progenitors. Osteoarthritis Cartilage. 2002 Apr;10 (4) :308-20.|[2]Moore EE, et al. Fibroblast growth factor-18 stimulates chondrogenesis and cartilage repair in a rat model of injury-induced osteoarthritis. Osteoarthritis Cartilage. 2005 Jul;13 (7) :623-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF1 Human Gene Knockout Kit (CRISPR)
KN401240 1 Kit

ARF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYH (MUTYH) (NM_001048173) Human Recombinant Protein
TP761725 50 µg

MYH (MUTYH) (NM_001048173) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802127 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Ccer1 Mouse Gene Knockout Kit (CRISPR)
KN502771 1 Kit

Ccer1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caspase 5 (CASP5) (NM_001136109) Human Over-expression Lysate
LC427803 20 µg

Caspase 5 (CASP5) (NM_001136109) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CSF1R/CD115 Protein (aa 20-517, His Tag)
PKSH032013-01 10 µg

Recombinant Human CSF1R/CD115 Protein (aa 20-517, His Tag)

Sign In for Pricing
View Details