Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Mouse

FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.

Product Specifications

Product Name Alternative

FGF-18 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-mouse.html

Purity

95.0

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG

Molecular Formula

14172 (Gene_ID) O89101 (E28-G207) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]Ellsworth JL, et al. Fibroblast growth factor-18 is a trophic factor for mature chondrocytes and their progenitors. Osteoarthritis Cartilage. 2002 Apr;10 (4) :308-20.|[2]Moore EE, et al. Fibroblast growth factor-18 stimulates chondrogenesis and cartilage repair in a rat model of injury-induced osteoarthritis. Osteoarthritis Cartilage. 2005 Jul;13 (7) :623-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ENO3/beta-enolase Monoclonal Antibody
AN300096P 100 µL

Recombinant ENO3/beta-enolase Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR559623 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
PSD3 Human Gene Knockout Kit (CRISPR)
KN420303 1 Kit

PSD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CPSF73 (CPSF3) Rabbit Monoclonal Antibody
TA424308 100 µL

CPSF73 (CPSF3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TBC1D3G (NM_001291462) Human Tagged ORF Clone
RG238851 10 µg

TBC1D3G (NM_001291462) Human Tagged ORF Clone

Sign In for Pricing
View Details
S100A9 + Calprotectin (S100A8/A9 Complex) (MAC3157R), 1mg/mL
BNUM3157-50 1x 50 µL

S100A9 + Calprotectin (S100A8/A9 Complex) (MAC3157R), 1mg/mL

Sign In for Pricing
View Details