Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Mouse

FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.

Product Specifications

Product Name Alternative

FGF-18 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-mouse.html

Purity

95.0

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG

Molecular Formula

14172 (Gene_ID) O89101 (E28-G207) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]Ellsworth JL, et al. Fibroblast growth factor-18 is a trophic factor for mature chondrocytes and their progenitors. Osteoarthritis Cartilage. 2002 Apr;10 (4) :308-20.|[2]Moore EE, et al. Fibroblast growth factor-18 stimulates chondrogenesis and cartilage repair in a rat model of injury-induced osteoarthritis. Osteoarthritis Cartilage. 2005 Jul;13 (7) :623-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Purpose Incubator BIGP-7601
BIGP-7601 1 Unit

General Purpose Incubator BIGP-7601

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS512050 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF647 conjugate, 0.1mg/mL
BNC471574-100 1x 100 µL

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648034 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD31 Antibody
F41048-0.08ML 0.08 mL

CD31 Antibody

Sign In for Pricing
View Details
Bone sialoprotein 2 Recombinant Rabbit monoclonal Antibody
HA751306 100 µL

Bone sialoprotein 2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details