Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP2, Human (His)

EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF4EBP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif4ebp2-protein-human-his.html

Purity

98.0

Smiles

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Molecular Formula

1979 (Gene_ID) Q13542 (M1-I120) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCDLPA Base
LA1590 250 g

SCDLPA Base

Sign In for Pricing
View Details
Ccdc158 (NM_177230) Mouse Tagged Lenti ORF Clone
MR224614L3 10 µg

Ccdc158 (NM_177230) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Retinoblastoma, Phosphorylated (S795) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 550)
MBS6435534-01 0.1 mL

Retinoblastoma, Phosphorylated (S795) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 550)

Sign In for Pricing
View Details
Retinoblastoma, Phosphorylated (S795) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 550)
MBS6435534-02 5x 0.1 mL

Retinoblastoma, Phosphorylated (S795) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 550)

Sign In for Pricing
View Details
Human TIGD7 Pre-designed siRNA Set A
SI016644A 1 Each

Human TIGD7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
bFGF Polyclonal Antibody Cy5 Conjugated
MBS9459817-01 0.1 mL

bFGF Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details