Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP2, Human (His)

EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF4EBP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif4ebp2-protein-human-his.html

Purity

98.0

Smiles

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Molecular Formula

1979 (Gene_ID) Q13542 (M1-I120) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKAG01573-2X96W - Phospho-IRS-1 (Ser1101) Colorimetric Cell-Based ELISA Kit
OKAG01573-2X96W 2x 96 Well Plates

OKAG01573-2X96W - Phospho-IRS-1 (Ser1101) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Endothelin A Receptor/ET-A Rabbit mAb
C06560-100uL*2 2x 100μL

Endothelin A Receptor/ET-A Rabbit mAb

Sign In for Pricing
View Details
IMDM With HEPES buffer. W/O L-glutamine, phenol red, and sodium bicarbonate.
IMP05-50LT 50 L

IMDM With HEPES buffer. W/O L-glutamine, phenol red, and sodium bicarbonate.

Sign In for Pricing
View Details
Chicken Deiodinase, Iodothyronine, Type I ELISA Kit
MBS100096 Inquire

Chicken Deiodinase, Iodothyronine, Type I ELISA Kit

Sign In for Pricing
View Details
TK1 Antibody, FITC conjugated
A36650-50UG 50 µg

TK1 Antibody, FITC conjugated

Sign In for Pricing
View Details
4,7-Dichloroindolin-2-one
YAA87222-01 50 mg

4,7-Dichloroindolin-2-one

Sign In for Pricing
View Details