Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 13 (CXCL13)

Product Specifications

Product Name Alternative

(Angie) (B cell-attracting chemokine 1) (BCA-1) (B lymphocyte chemoattractant) (CXC chemokine BLC) (Small-inducible cytokine B13)

Abbreviation

Recombinant Human CXCL13 protein

Gene Name

CXCL13

UniProt

O43927

Expression Region

23-109aa

Organism

Homo sapiens (Human)

Target Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Antimicrobial peptide which inhibits the growth of a variety of fungi, oomycetes, Gram-positive bacterial phytopatogenes and S.cerevisiae in vitro. No activity against E.coli.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.8 kDa

References & Citations

"MiAMP1, a novel protein from Macadamia integrifolia adopts a Greek key beta-barrel fold unique amongst plant antimicrobial proteins." McManus A.M., Nielsen K.J., Marcus J.P., Harrison S.J., Green J.L., Manners J.M., Craik D.J. J. Mol. Biol. 293:629-638 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)
MBS7071744-01 0.05 mg (E-Coli)

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)
MBS7071744-02 0.05 mg (Baculovirus)

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)
MBS7071744-03 0.2 mg (E-Coli)

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)
MBS7071744-04 0.5 mg (E-Coli)

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)
MBS7071744-05 0.2 mg (Yeast)

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)
MBS7071744-06 0.05 mg (Mammalian-Cell)

Recombinant Shewanella frigidimarina Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details