Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HN1, Mouse (His)

HN1 protein negatively regulates AKT-mediated GSK3B signaling and induces the phosphorylation and degradation of CTNNB1 at “Ser-33”. This effect inhibits the “Ser-9” phosphorylation of GSK3B, inhibits the activity of APC:CTNNB1:GSK3B complex and blocks its interaction with CDH1. HN1 Protein, Mouse (His) is the recombinant mouse-derived HN1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HN1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hn1-protein-mouse-his.html

Purity

98.0

Smiles

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG

Molecular Formula

15374 (Gene_ID) P97825 (M1-G154) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Myosin VIIa MYO7A Antibody
A03915 100 µL

Anti-Myosin VIIa MYO7A Antibody

Sign In for Pricing
View Details
Rosavin
C09668-5mg 5 mg

Rosavin

Sign In for Pricing
View Details
Histone H3 Antibody
UMA00125 100 µL

Histone H3 Antibody

Sign In for Pricing
View Details
BCDIN3 CRISPR Activation Plasmid (m)
sc-433104-ACT 20 µg

BCDIN3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit polyclonal anti-HDAC7 antibody
TA318926 100 µg

Rabbit polyclonal anti-HDAC7 antibody

Sign In for Pricing
View Details
C1D Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14101062 1.0 µg DNA

C1D Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details