Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST1R Protein (C-His, Human)
P526905 100 µg

MST1R Protein (C-His, Human)

Sign In for Pricing
View Details
MRX26 Protein Vector (Human) (pPB-C-His)
PV101426 500 ng

MRX26 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
UTP15 (NM_032175) Human Tagged ORF Clone Lentiviral Particle
RC221149L4V 200 µL

UTP15 (NM_032175) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cenpn sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7342108 1.0 µg DNA

Cenpn sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse regulated on activation in normal T-cell expressed and secreted, RANTES/CCL5 ELISA kit
YLA0869MO-01 48 Tests

Mouse regulated on activation in normal T-cell expressed and secreted, RANTES/CCL5 ELISA kit

Sign In for Pricing
View Details
Mouse regulated on activation in normal T-cell expressed and secreted, RANTES/CCL5 ELISA kit
YLA0869MO-02 96 Tests

Mouse regulated on activation in normal T-cell expressed and secreted, RANTES/CCL5 ELISA kit

Sign In for Pricing
View Details