Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O1:K1/APEC rpsB Polyclonal Antibody
MBS7166853 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC rpsB Polyclonal Antibody

Sign In for Pricing
View Details
PTPN14, CT (PTPN14, PEZ, Tyrosine-protein phosphatase non-receptor type 14, Protein-tyrosine phosphatase pez) (MaxLight 490)
MBS6338959-01 0.1 mL

PTPN14, CT (PTPN14, PEZ, Tyrosine-protein phosphatase non-receptor type 14, Protein-tyrosine phosphatase pez) (MaxLight 490)

Sign In for Pricing
View Details
PTPN14, CT (PTPN14, PEZ, Tyrosine-protein phosphatase non-receptor type 14, Protein-tyrosine phosphatase pez) (MaxLight 490)
MBS6338959-02 5x 0.1 mL

PTPN14, CT (PTPN14, PEZ, Tyrosine-protein phosphatase non-receptor type 14, Protein-tyrosine phosphatase pez) (MaxLight 490)

Sign In for Pricing
View Details
Plek2 Mouse shRNA Lentiviral Particle (Locus ID 27260)
TL502680V 500 µL Each

Plek2 Mouse shRNA Lentiviral Particle (Locus ID 27260)

Sign In for Pricing
View Details
PLD4 Protein Vector (Human) (pPM-C-His)
PV031664 500 ng

PLD4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Human CD3 (Alexa Fluor 488)
MBS8559316-01 0.1 mL

Mouse Human CD3 (Alexa Fluor 488)

Sign In for Pricing
View Details