Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit
AE15604HU-01 48 Tests

Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit

Sign In for Pricing
View Details
Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit
AE15604HU-02 96 Tests

Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit

Sign In for Pricing
View Details
ARD1A (NAA10) (NM_001256119) Human Tagged ORF Clone
RC232182 10 µg

ARD1A (NAA10) (NM_001256119) Human Tagged ORF Clone

Sign In for Pricing
View Details
P70 S6 Kinase, phosphorylated (Thr421, Ser424) (p70 S6K) discontinued
P1001-37E1 100 µL

P70 S6 Kinase, phosphorylated (Thr421, Ser424) (p70 S6K) discontinued

Sign In for Pricing
View Details
ASPH Knockout AGS Polyclonal Cells
ARG26670 1 Million

ASPH Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Mouse Ecm2 qPCR Primer Pair
QM74470S 200 Tests

Mouse Ecm2 qPCR Primer Pair

Sign In for Pricing
View Details