Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ltc4s 3'UTR Luciferase Stable Cell Line
TU212656 1.0 mL

Ltc4s 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CSNK2A1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0517908 1.0 µg DNA

CSNK2A1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Tas2r134 AAV siRNA Pooled Vector
46168166 1.0 µg

Tas2r134 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
OTUD6B Polyclonal Antibody
MBS8569204-01 0.1 mL

OTUD6B Polyclonal Antibody

Sign In for Pricing
View Details
OTUD6B Polyclonal Antibody
MBS8569204-02 0.1 mL (AF405L)

OTUD6B Polyclonal Antibody

Sign In for Pricing
View Details
OTUD6B Polyclonal Antibody
MBS8569204-03 0.1 mL (AF405S)

OTUD6B Polyclonal Antibody

Sign In for Pricing
View Details