Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Soyabean Casein Digest Medium (SCDM) (Tryptone Soya Broth, TSB) BioVeg
51993-1 500 Gms

Soyabean Casein Digest Medium (SCDM) (Tryptone Soya Broth, TSB) BioVeg

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD119 Antibody
JOT21411F 50μg

AF/LE Purified Anti-Mouse CD119 Antibody

Sign In for Pricing
View Details
Olfr677 sgRNA CRISPR Lentivector set (Mouse)
K4169301 3x 1.0 µg

Olfr677 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
TRNAL37 sgRNA CRISPR Lentivector (Human) (Target 1)
K2503502 1.0 µg DNA

TRNAL37 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HMGB1 Protein Vector (Mouse) (pPB-C-His)
PV189158 500 ng

HMGB1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Tbccd1 3'UTR Luciferase Stable Cell Line
TU120219 1.0 mL

Tbccd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details