Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLS1 (NM_001127458) Human Over-expression Lysate
LY426793 100 µg

CRLS1 (NM_001127458) Human Over-expression Lysate

Sign In for Pricing
View Details
Gan sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6058506 1.0 µg DNA

Gan sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RPS16P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42158151 3x 1.0 µg DNA

RPS16P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Pongo abelii SH3 domain-binding protein 5-like (SH3BP5L)
MBS1334996-01 0.02 mg (E-Coli)

Recombinant Pongo abelii SH3 domain-binding protein 5-like (SH3BP5L)

Sign In for Pricing
View Details
Recombinant Pongo abelii SH3 domain-binding protein 5-like (SH3BP5L)
MBS1334996-02 0.02 mg (Yeast)

Recombinant Pongo abelii SH3 domain-binding protein 5-like (SH3BP5L)

Sign In for Pricing
View Details
Recombinant Pongo abelii SH3 domain-binding protein 5-like (SH3BP5L)
MBS1334996-03 0.1 mg (E-Coli)

Recombinant Pongo abelii SH3 domain-binding protein 5-like (SH3BP5L)

Sign In for Pricing
View Details