Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filaggrin (FLG) BioAssayTM ECL ELISA Kit (Human)
157653 96 Tests

Filaggrin (FLG) BioAssayTM ECL ELISA Kit (Human)

Sign In for Pricing
View Details
Lentiviral human BPNT1 sgRNA gene knockout kit - Lentiviral human BPNT1 sgRNA gene knockout kit (25)
GTR15363918 1 Vial

Lentiviral human BPNT1 sgRNA gene knockout kit - Lentiviral human BPNT1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Nephrin (NPHS1) (NM_004646) Human Tagged ORF Clone Lentiviral Particle
RC217677L2V 200 µL

Nephrin (NPHS1) (NM_004646) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Tgm1 shRNA (UAS) - Lentiviral mouse Tgm1 shRNA (UAS, iRFP) plasmid
GTR15134584 1 Vial

Lentiviral mouse Tgm1 shRNA (UAS) - Lentiviral mouse Tgm1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LIM Kinase 1+2 Antibody (YA5556, Mouse)
HY-P85864 1 Each

LIM Kinase 1+2 Antibody (YA5556, Mouse)

Sign In for Pricing
View Details
RPSAP14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42665111 3x 1.0 µg

RPSAP14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details