Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr112 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4230405 3x 1.0 µg

Olfr112 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
HSD17B11 Knockout huh-7 Polyclonal Cells
ARG28335 1 Million

HSD17B11 Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
Zbtb11 ORF Vector (Rat) (pORF)
ORF079277 1.0 µg DNA

Zbtb11 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Tetrahydrocannabinol (THC) (MaxLight 750)
MBS6257413-01 0.1 mL

Tetrahydrocannabinol (THC) (MaxLight 750)

Sign In for Pricing
View Details
Tetrahydrocannabinol (THC) (MaxLight 750)
MBS6257413-02 5x 0.1 mL

Tetrahydrocannabinol (THC) (MaxLight 750)

Sign In for Pricing
View Details
Rgr sgRNA CRISPR Lentivector (Rat) (Target 2)
K6739803 1.0 µg DNA

Rgr sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details