Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CGGBP1 Antibody [Alexa Fluor 405]
NBP2-22324AF405 0.1 mL

Rabbit Polyclonal CGGBP1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
ST8SIA4 (NM_005668) Human Tagged ORF Clone
RG208764 10 µg

ST8SIA4 (NM_005668) Human Tagged ORF Clone

Sign In for Pricing
View Details
GTPase HRAS Polyclonal Antibody, APC Conjugated
bs-6165R-APC 100 µL

GTPase HRAS Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal AHR Antibody (RPT9) [DyLight 350]
NB300-515UV 0.1 mL

Mouse Monoclonal AHR Antibody (RPT9) [DyLight 350]

Sign In for Pricing
View Details
6820408C15Rik (NM_177656) Mouse Tagged ORF Clone
MR213995 10 µg

6820408C15Rik (NM_177656) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CA8 Rabbit Polyclonal Antibody
TA346372 100 µL

CA8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details