Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBCC Rabbit pAb (APR23785N)
APR23785N-01 50 µL

TBCC Rabbit pAb (APR23785N)

Sign In for Pricing
View Details
TBCC Rabbit pAb (APR23785N)
APR23785N-02 100 µL

TBCC Rabbit pAb (APR23785N)

Sign In for Pricing
View Details
TBCC Rabbit pAb (APR23785N)
APR23785N-03 200 µL

TBCC Rabbit pAb (APR23785N)

Sign In for Pricing
View Details
Anti-Human COL6A3 Antibody (SAA1530)
MBS1570490-01 0.1 mg

Anti-Human COL6A3 Antibody (SAA1530)

Sign In for Pricing
View Details
Anti-Human COL6A3 Antibody (SAA1530)
MBS1570490-02 1 mg

Anti-Human COL6A3 Antibody (SAA1530)

Sign In for Pricing
View Details
Anti-Human COL6A3 Antibody (SAA1530)
MBS1570490-03 5x 1 mg

Anti-Human COL6A3 Antibody (SAA1530)

Sign In for Pricing
View Details