Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK14 Antibody / Cytokeratin 14 / KRT14
V4479-100UG 100 µg

CK14 Antibody / Cytokeratin 14 / KRT14

Sign In for Pricing
View Details
WDPCP (NM_001042692) Human Over-expression Lysate
LC421027 20 µg

WDPCP (NM_001042692) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Hepc (Hepcidin) ELISA Kit
E-EL-H6202-01 24 Tests

Human Hepc (Hepcidin) ELISA Kit

Sign In for Pricing
View Details
Human Hepc (Hepcidin) ELISA Kit
E-EL-H6202-02 48 Tests

Human Hepc (Hepcidin) ELISA Kit

Sign In for Pricing
View Details
Human Hepc (Hepcidin) ELISA Kit
E-EL-H6202-03 96 Tests

Human Hepc (Hepcidin) ELISA Kit

Sign In for Pricing
View Details
Bovine Fatty acid-binding protein, liver (FABP1) ELISA Kit
OM621612 96 Strip Well

Bovine Fatty acid-binding protein, liver (FABP1) ELISA Kit

Sign In for Pricing
View Details