Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUB1 Rabbit Monoclonal Antibody [Clone ID: R04-6I3]
TA384914 100 µL

OTUB1 Rabbit Monoclonal Antibody [Clone ID: R04-6I3]

Sign In for Pricing
View Details
Pcdhga8 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4052902 1.0 µg DNA

Pcdhga8 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
(Z) -JIB-04 50mg
A22137-50 50 mg

(Z) -JIB-04 50mg

Sign In for Pricing
View Details
Restin/CLIP1 (Biotin)
551522 100 µg

Restin/CLIP1 (Biotin)

Sign In for Pricing
View Details
ATQL2 sgRNA CRISPR Lentivector set (Human)
K0156801 3x 1.0 µg

ATQL2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
HSC70 Interacting Protein (HIP, AAG2, FAM10A1, FAM10A4, FLJ27260, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, SNC6, ST13,
MBS6481186-01 0.2 mL

HSC70 Interacting Protein (HIP, AAG2, FAM10A1, FAM10A4, FLJ27260, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, SNC6, ST13,

Sign In for Pricing
View Details