Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2T (Ubiquitin-conjugating Enzyme E2T (Putative), HSPC150, PIG50) (MaxLight 750) discontinued
253218-ML750 100 µL

UBE2T (Ubiquitin-conjugating Enzyme E2T (Putative), HSPC150, PIG50) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Human ZDHHC19 Protein - (Dry Ice)
H00131540-P01-10ug 10 µg

Recombinant Human ZDHHC19 Protein - (Dry Ice)

Sign In for Pricing
View Details
pLV3×FLAG-CopGFP-Puro Plasmid
PVT61581 2 µg

pLV3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Parotid (Frozen) HisTekTM
T5595-5003 5 Sections

Tissue, Section, Human Adult Normal, Parotid (Frozen) HisTekTM

Sign In for Pricing
View Details
Mouse Monoclonal Glutathione S-Transferase pi 1/GSTP1 Antibody (OTI4B6) [DyLight 488]
NBP2-70857G 0.1 mL

Mouse Monoclonal Glutathione S-Transferase pi 1/GSTP1 Antibody (OTI4B6) [DyLight 488]

Sign In for Pricing
View Details
GNPDA1 Antibody (ascites) [AMM04840G]
AMM04840G-01 50 µL

GNPDA1 Antibody (ascites) [AMM04840G]

Sign In for Pricing
View Details