Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB5, NT (ABCB5, ATP-binding cassette sub-family B member 5, ABCB5 P-gp, P-glycoprotein ABCB5) (HRP) discontinued
031473-HRP 200 µL

ABCB5, NT (ABCB5, ATP-binding cassette sub-family B member 5, ABCB5 P-gp, P-glycoprotein ABCB5) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Dbx1 qPCR Primer Pair
QM11970S 200 Tests

Mouse Dbx1 qPCR Primer Pair

Sign In for Pricing
View Details
DHB13, NT (HSD17B13, SCDR9, 17-beta-hydroxysteroid dehydrogenase 13, Short-chain dehydrogenase/reductase 9) (APC) discontinued
034606-APC 100 µL

DHB13, NT (HSD17B13, SCDR9, 17-beta-hydroxysteroid dehydrogenase 13, Short-chain dehydrogenase/reductase 9) (APC) discontinued

Sign In for Pricing
View Details
TNFRSF25 Rabbit pAb
A9783 200 µL

TNFRSF25 Rabbit pAb

Sign In for Pricing
View Details
C3orf39 Recombinant Protein Antigen
NBP1-89205PEP 0.1 mL

C3orf39 Recombinant Protein Antigen

Sign In for Pricing
View Details
Mouse Luteinizing Hormone Beta Polypeptide (LHb) Antibody Pair Kit (with Standard)
MBS2101833-01 5x 96 Tests

Mouse Luteinizing Hormone Beta Polypeptide (LHb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details