Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benoxafos
HY-17524 1 Each

Benoxafos

Sign In for Pricing
View Details
HCK (Hematopoietic Cellular Kinase, p59-HCK/p60-HCK, Tyrosine-protein Kinase HCK, Hemopoietic Cell Kinase) (MaxLight 750)
MBS6231093-01 0.1 mL

HCK (Hematopoietic Cellular Kinase, p59-HCK/p60-HCK, Tyrosine-protein Kinase HCK, Hemopoietic Cell Kinase) (MaxLight 750)

Sign In for Pricing
View Details
HCK (Hematopoietic Cellular Kinase, p59-HCK/p60-HCK, Tyrosine-protein Kinase HCK, Hemopoietic Cell Kinase) (MaxLight 750)
MBS6231093-02 5x 0.1 mL

HCK (Hematopoietic Cellular Kinase, p59-HCK/p60-HCK, Tyrosine-protein Kinase HCK, Hemopoietic Cell Kinase) (MaxLight 750)

Sign In for Pricing
View Details
NSDHL Antibody, Biotin conjugated
A55078-50UG 50 µg

NSDHL Antibody, Biotin conjugated

Sign In for Pricing
View Details
S100A11 Protein Vector (Human) (pPB-C-His)
PV036641 500 ng

S100A11 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal NOL8 Antibody [Biotin]
NBP1-46850B 0.1 mL

Rabbit Polyclonal NOL8 Antibody [Biotin]

Sign In for Pricing
View Details