Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse MESDC2 Protein, His, E.coli-2ug
QP12681-2ug 2ug

Recombinant Mouse MESDC2 Protein, His, E.coli-2ug

Sign In for Pricing
View Details
Rae1 (BC060072) Mouse Tagged Lenti ORF Clone
MR202613L4 10 µg

Rae1 (BC060072) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lambda Light Chain (Bence Jones Protein, BJP, IGLC 1/2/3, Mcg Marker, ParaProtein) (BSA & Azide Free) (MaxLight 490)
172120-AF-ML490 100 µL

Lambda Light Chain (Bence Jones Protein, BJP, IGLC 1/2/3, Mcg Marker, ParaProtein) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
FXYD1 (Phospholemman , FXYD domain containing ion transport regulator 1)
350627 100 µg

FXYD1 (Phospholemman , FXYD domain containing ion transport regulator 1)

Sign In for Pricing
View Details
Rat Alox5ap Pre-designed siRNA Set A
SI200540A 1 Each

Rat Alox5ap Pre-designed siRNA Set A

Sign In for Pricing
View Details
FGFR2 (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (AP)
MBS6131291-01 0.1 mL

FGFR2 (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (AP)

Sign In for Pricing
View Details