Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

tar Antibody
A51367-50UG 50 µg

tar Antibody

Sign In for Pricing
View Details
Lenti ORF particles, FNBP1L (mGFP-tagged)-Human formin binding protein 1-like (FNBP1L), transcript variant 2, 200ul, >10^7 TU/mL
RC217933L4V 200 µL

Lenti ORF particles, FNBP1L (mGFP-tagged)-Human formin binding protein 1-like (FNBP1L), transcript variant 2, 200ul, >10^7 TU/mL

Sign In for Pricing
View Details
Zinc Alpha 2 Glycoprotein Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62121R-BF594 100 µL

Zinc Alpha 2 Glycoprotein Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rabbit anti-human peptidylprolyl isomerase (cyclophilin)-like 5 polyclonal Antibody
MBS714236-01 0.1 mL

Rabbit anti-human peptidylprolyl isomerase (cyclophilin)-like 5 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human peptidylprolyl isomerase (cyclophilin)-like 5 polyclonal Antibody
MBS714236-02 5x 0.1 mL

Rabbit anti-human peptidylprolyl isomerase (cyclophilin)-like 5 polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TRIM27 Antibody (PCRP-TRIM27-1B3) [DyLight 405]
NBP3-08579V 100 µL

Mouse Monoclonal TRIM27 Antibody (PCRP-TRIM27-1B3) [DyLight 405]

Sign In for Pricing
View Details