Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Novyi recR Protein (aa 1-198)
VAng-Lsx00096-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Novyi recR Protein (aa 1-198)

Sign In for Pricing
View Details
Vmn1r65 Protein Lysate (Mouse) with C-HA Tag
49693034 100 µg

Vmn1r65 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
IKB alpha (pY42) Blocking Peptide
MBS8244226-01 1 mg

IKB alpha (pY42) Blocking Peptide

Sign In for Pricing
View Details
IKB alpha (pY42) Blocking Peptide
MBS8244226-02 5 mg

IKB alpha (pY42) Blocking Peptide

Sign In for Pricing
View Details
IKB alpha (pY42) Blocking Peptide
MBS8244226-03 5x 5 mg

IKB alpha (pY42) Blocking Peptide

Sign In for Pricing
View Details
LY6E, ID (LY6E, 9804, RIGE, SCA2, TSA1, Lymphocyte antigen 6E, Retinoic acid-induced gene E protein, Stem cell antigen 2, Thymic shared antigen 1) (MaxLight 750) discontinued
038014-ML750 100 µL

LY6E, ID (LY6E, 9804, RIGE, SCA2, TSA1, Lymphocyte antigen 6E, Retinoic acid-induced gene E protein, Stem cell antigen 2, Thymic shared antigen 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details