Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMGP, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OMGP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/omgp-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Molecular Formula

18377 (Gene_ID) Q63912 (I25-T245) (Accession)

Molecular Weight

Approximately 40-52 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: 429]
DM1011 500 µg

GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: 429]

Sign In for Pricing
View Details
Rabbit Polyclonal HECTD3 Antibody
NBP1-82153-25ul 25 µL

Rabbit Polyclonal HECTD3 Antibody

Sign In for Pricing
View Details
Anti-Inter Alpha-Globulin Inhibitor H1 (ITIH1)
FY-AB51709-01 1 mL

Anti-Inter Alpha-Globulin Inhibitor H1 (ITIH1)

Sign In for Pricing
View Details
Anti-Inter Alpha-Globulin Inhibitor H1 (ITIH1)
FY-AB51709-02 100 µL

Anti-Inter Alpha-Globulin Inhibitor H1 (ITIH1)

Sign In for Pricing
View Details
Anti-Inter Alpha-Globulin Inhibitor H1 (ITIH1)
FY-AB51709-03 200 µL

Anti-Inter Alpha-Globulin Inhibitor H1 (ITIH1)

Sign In for Pricing
View Details
BubR1 (BUB1B) Mouse Monoclonal Antibody [Clone ID: OTI3C7]
CF500534 100 µg

BubR1 (BUB1B) Mouse Monoclonal Antibody [Clone ID: OTI3C7]

Sign In for Pricing
View Details