Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS4), partial

Product Specifications

Product Name Alternative

ADAM-TS 4; ADAM-TS4; ADAMTS-4; ADMP-1; Aggrecanase-1

Abbreviation

Recombinant Human ADAMTS4 protein, partial

Gene Name

ADAMTS4

UniProt

O75173

Expression Region

213-319aa

Organism

Homo sapiens (Human)

Target Sequence

FASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQ

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-|-Ala-393' site.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.0 kDa

References & Citations

"Sites of aggrecan cleavage by recombinant human aggrecanase-1 (ADAMTS-4) ." Tortorella M.D., Pratta M., Liu R.Q., Austin J., Ross O.H., Abbaszade I., Burn T., Arner E. J Biol Chem 275:18566-18573 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA6 Knockout SK-HEP-1 Polyclonal Cells
ARG32194 1 Million

ANXA6 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
ANXA13 Antibody
A53089-50UL 50 μL

ANXA13 Antibody

Sign In for Pricing
View Details
Mgst3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3501305 3x 1.0 µg

Mgst3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse TBG (Thyroxine Binding Globulin) ELISA Kit
EM1390 96 Tests

Mouse TBG (Thyroxine Binding Globulin) ELISA Kit

Sign In for Pricing
View Details
FAM105A (Biotin)
562030-01 50 µg

FAM105A (Biotin)

Sign In for Pricing
View Details
FAM105A (Biotin)
562030-02 100 µg

FAM105A (Biotin)

Sign In for Pricing
View Details