Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMW-PTP/ACP1, Human (His)

LMW-PTP/ACP1, a phosphatase, acts on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and natural and synthetic acyl phosphates. Notably, there are substrate specificity differences between isoform 1 and isoform 2, with isoform 2 lacking phosphatase activity. LMW-PTP/ACP1 Protein, Human (His) is the recombinant human-derived LMW-PTP/ACP1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LMW-PTP/ACP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lmw-ptp-acp1-protein-human-c-his.html

Purity

95.0

Smiles

AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Molecular Formula

52 (Gene_ID) P24666-2 (A2-H158) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leucyl tRNA synthetase (LARS) (C-term) Rabbit Polyclonal Antibody
AP14056PU-N 400 µL

Leucyl tRNA synthetase (LARS) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 17A (IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8)
168310 100 µg

Interleukin 17A (IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8)

Sign In for Pricing
View Details
2- ((4-Oxo-3-phenyl-3,4,6,7-tetrahydrothieno[3,2-d]pyrimidin-2-yl) thio) -N- (5-phenylpyridin-2-yl) acetamide
sc-477902 10 mg

2- ((4-Oxo-3-phenyl-3,4,6,7-tetrahydrothieno[3,2-d]pyrimidin-2-yl) thio) -N- (5-phenylpyridin-2-yl) acetamide

Sign In for Pricing
View Details
Olfr1352 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32803154 3x 1.0 µg DNA

Olfr1352 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
GNRR2 Polyclonal Antibody
ABP58660-01 30 µL

GNRR2 Polyclonal Antibody

Sign In for Pricing
View Details
GNRR2 Polyclonal Antibody
ABP58660-02 100 µL

GNRR2 Polyclonal Antibody

Sign In for Pricing
View Details