Latexin, Human (His)
Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
Latexin Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/latexin-protein-human-his.html
Purity
98.0
Smiles
EIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Molecular Formula
56925 (Gene_ID) Q9BS40/NP_064554.3 (E2-E222) (Accession)
Molecular Weight
30-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040158-500 1x 500 µL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470912-500 1x 500 µL
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041841-100 1x 100 µL
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details