Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Latexin, Human (His)

Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Latexin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/latexin-protein-human-his.html

Purity

98.0

Smiles

EIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Molecular Formula

56925 (Gene_ID) Q9BS40/NP_064554.3 (E2-E222) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tribo™ Shiga Toxin (STX) Rapid Test Strip Kit (20 strips/pack)
TBS11151 20 strips/pack

Tribo™ Shiga Toxin (STX) Rapid Test Strip Kit (20 strips/pack)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)
MBS2061000-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)
MBS2061000-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)
MBS2061000-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)
MBS2061000-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)
MBS2061000-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Monoamine Oxidase A (MAOA)

Sign In for Pricing
View Details