Clusterin/APOJ, Human (HEK293, His)
Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the C-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD) [1].
Product Specifications
Product Name Alternative
Clusterin/APOJ Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-human-hek-293-his.html
Purity
96.00
Smiles
DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Molecular Formula
1191 (Gene_ID) P10909-1 (D23-E449) (Accession)
Molecular Weight
Approximately (28-40) & 60.96 kDa
References & Citations
[1]Evangeline M Foster, et al. Clusterin in Alzheimer's Disease: Mechanisms, Genetics, and Lessons From Other Pathologies. Front Neurosci. 2019 Feb 28;13:164.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881037-500 1x 500 µL
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
