Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Major urinary 11, Mouse (His)

Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) . Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Major urinary protein 11 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/major-urinary-protein-11-protein-mouse-his.html

Smiles

REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Molecular Formula

100039028 (Gene_ID) P04938 (E32-E181) (Accession)

Molecular Weight

Approximately 23.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit
E-EL-H2376-01 24 Tests

Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit
E-EL-H2376-02 48 Tests

Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit
E-EL-H2376-03 96 Tests

Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Aminopeptidase A (ENPEP) (NM_001977) Human Over-expression Lysate
LY419610 100 µg

Aminopeptidase A (ENPEP) (NM_001977) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF594 conjugate, 0.1mg/mL
BNC942571-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Aurka activation kit by CRISPRa
GA204145 1 Kit

Mouse Aurka activation kit by CRISPRa

Sign In for Pricing
View Details