Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Major urinary 11, Mouse (His)

Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) . Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Major urinary protein 11 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/major-urinary-protein-11-protein-mouse-his.html

Smiles

REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Molecular Formula

100039028 (Gene_ID) P04938 (E32-E181) (Accession)

Molecular Weight

Approximately 23.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA2 (NM_006540) Human Over-expression Lysate
LY401959 100 µg

NCOA2 (NM_006540) Human Over-expression Lysate

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1672), CF568 conjugate, 0.1mg/mL
BNC681672-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1672), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuantiFluo™ Caspase-3 Assay Kit
DCS3-100 100 Tests

QuantiFluo™ Caspase-3 Assay Kit

Sign In for Pricing
View Details
UQCRFS1 Rabbit Polyclonal Antibody
TA383129 100 µL

UQCRFS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sulfur Trioxide Triethylamine Complex
TRC-S789455-5G 5 g

Sulfur Trioxide Triethylamine Complex

Sign In for Pricing
View Details
NVL Human Gene Knockout Kit (CRISPR)
KN415387 1 Kit

NVL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details