Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

Gp32; Helix-destabilizing protein

Abbreviation

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

Gene Name

32

UniProt

P03695

Expression Region

1-301aa

Organism

Enterobacteria phage T4 (Bacteriophage T4)

Target Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCCB Antibody Blocking peptide
orb1444796 500 µg

PCCB Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Neurospora crassa Vacuolar protein sorting/targeting protein 10 (vps10), partial
MBS7089328 Inquire

Recombinant Neurospora crassa Vacuolar protein sorting/targeting protein 10 (vps10), partial

Sign In for Pricing
View Details
RPL9P29 3'UTR Luciferase Stable Cell Line
TU020658 1.0 mL

RPL9P29 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZMYND10 (Zinc Finger, MYND-Type Containing 10, BLU, FLU) (AP) discontinued
253638-AP 100 µL

ZMYND10 (Zinc Finger, MYND-Type Containing 10, BLU, FLU) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Fumarate reductase subunit C (frdC)
MBS1107170 Inquire

Recombinant Shigella boydii serotype 18 Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details
ATF-3 (A-8) FITC
sc-518032 FITC 200 µg/mL

ATF-3 (A-8) FITC

Sign In for Pricing
View Details