Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

Gp32; Helix-destabilizing protein

Abbreviation

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

Gene Name

32

UniProt

P03695

Expression Region

1-301aa

Organism

Enterobacteria phage T4 (Bacteriophage T4)

Target Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taz (NM_181516) Mouse Tagged Lenti ORF Clone
MR203448L3 10 µg

Taz (NM_181516) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DAP Kinase 2 Antibody
orb1337874 100 µg

DAP Kinase 2 Antibody

Sign In for Pricing
View Details
Anti-TUB 1 Antibody Picoband® (Dylight488 Conjugate)
A02917-1-Dylight488 100 µg

Anti-TUB 1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Specimen of Bat in Jar
4113700/4A 1 Each

Specimen of Bat in Jar

Sign In for Pricing
View Details
Recombinant Escherichia coli Pyrimidine-specific ribonucleoside hydrolase rihB (rihB)
MBS1342329-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Pyrimidine-specific ribonucleoside hydrolase rihB (rihB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Pyrimidine-specific ribonucleoside hydrolase rihB (rihB)
MBS1342329-02 0.02 mg (Yeast)

Recombinant Escherichia coli Pyrimidine-specific ribonucleoside hydrolase rihB (rihB)

Sign In for Pricing
View Details