Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

Gp32; Helix-destabilizing protein

Abbreviation

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

Gene Name

32

UniProt

P03695

Expression Region

1-301aa

Organism

Enterobacteria phage T4 (Bacteriophage T4)

Target Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fgf7 shRNA (UAS) - Lentiviral mouseFgf7 shRNA (UAS, GFP) (25)
GTR15252260 1 Vial

Lentiviral mouse Fgf7 shRNA (UAS) - Lentiviral mouseFgf7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Cytochrome b6 (petB)
MBS7025693-01 0.02 mg

Recombinant Gloeobacter violaceus Cytochrome b6 (petB)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Cytochrome b6 (petB)
MBS7025693-02 0.1 mg

Recombinant Gloeobacter violaceus Cytochrome b6 (petB)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Cytochrome b6 (petB)
MBS7025693-03 5x 0.1 mg

Recombinant Gloeobacter violaceus Cytochrome b6 (petB)

Sign In for Pricing
View Details
Zmym6 ORF Vector (Rat) (pORF)
ORF079581 1.0 µg DNA

Zmym6 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Arp3 (Actin Like Protein 3) (AP) discontinued
A3575-AP 100 µL

Arp3 (Actin Like Protein 3) (AP) discontinued

Sign In for Pricing
View Details