Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG, Human (HEK293, His, solution)

MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293, His, solution) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MOG Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mog-protein-human-hek-293-his.html

Purity

98.0

Smiles

GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Molecular Formula

4340 (Gene_ID) Q16653-1 (G30-G154) (Accession)

Molecular Weight

18-25 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

InVivoMAb Anti-Human CDH11 Antibody (SYN0012)
VHF12002 100 μg

InVivoMAb Anti-Human CDH11 Antibody (SYN0012)

Sign In for Pricing
View Details
Klhl1 Antibody - N-terminal region (ARP34466_P050)
ARP34466_P050 100 µL

Klhl1 Antibody - N-terminal region (ARP34466_P050)

Sign In for Pricing
View Details
Rabbit Monoclonal Thymidine glycol Antibody (B29) [Alexa Fluor 350]
NBP3-11041AF350 0.1 mL

Rabbit Monoclonal Thymidine glycol Antibody (B29) [Alexa Fluor 350]

Sign In for Pricing
View Details
PSMB1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV693112 1.0 µg DNA

PSMB1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Neisseria gonorrhoeae Formate--tetrahydrofolate ligase (fhs), partial
MBS1396885 Inquire

Recombinant Neisseria gonorrhoeae Formate--tetrahydrofolate ligase (fhs), partial

Sign In for Pricing
View Details
Ceramide synthase 2 Polyclonal Antibody, FITC Conjugated
bs-5077R-FITC-TR 20 µL

Ceramide synthase 2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details