Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG, Human (HEK293, His, solution)

MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293, His, solution) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MOG Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mog-protein-human-hek-293-his.html

Purity

98.0

Smiles

GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Molecular Formula

4340 (Gene_ID) Q16653-1 (G30-G154) (Accession)

Molecular Weight

18-25 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDH Chemi-Luminescent ELISA Kit (Human)
OKCD03500-96W 96 Well

GAPDH Chemi-Luminescent ELISA Kit (Human)

Sign In for Pricing
View Details
C1orf229 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-15063R-BF405 100 µL

C1orf229 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
THAP8 siRNA (Human)
orb1852043-01 15 nmol

THAP8 siRNA (Human)

Sign In for Pricing
View Details
THAP8 siRNA (Human)
orb1852043-02 30 nmol

THAP8 siRNA (Human)

Sign In for Pricing
View Details
INCENP Antibody - C-terminal region (ARP63541_P050)
ARP63541_P050 100 µL

INCENP Antibody - C-terminal region (ARP63541_P050)

Sign In for Pricing
View Details
TIMM9 Antibody, HRP conjugated
A72416-100UG 100 µg

TIMM9 Antibody, HRP conjugated

Sign In for Pricing
View Details