Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blot21, Blomia tropicalis (His)

Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Blot21 Protein, Blomia tropicalis (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/blot21-protein-blomia-tropicalis-his.html

Purity

95.0

Smiles

LPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE

Molecular Formula

/ (Gene_ID) AAX34047.1 (L17-E129) (Accession)

Molecular Weight

Approximately 13.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-Diethyl-2-[ (2-methylphenyl) amino]-benzamide-d7
165512 25 mg

N, N-Diethyl-2-[ (2-methylphenyl) amino]-benzamide-d7

Sign In for Pricing
View Details
Veraguensine
AB2114 20 mg

Veraguensine

Sign In for Pricing
View Details
4930403N07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3075408 1.0 µg DNA

4930403N07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
RNF157 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1839708 1.0 µg DNA

RNF157 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
UBE3C (Ubiquitin-Protein Ligase E3C)
495049 100 µL

UBE3C (Ubiquitin-Protein Ligase E3C)

Sign In for Pricing
View Details
Recombinant Human Tie-1 protein
MBS201376-01 0.01 mg

Recombinant Human Tie-1 protein

Sign In for Pricing
View Details