Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C1q and TNF related 3 (C1qtnf3)

Product Specifications

Abbreviation

Recombinant Rat C1qtnf3 protein

Gene Name

C1qtnf3

UniProt

B1WC91

Expression Region

23-319aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QDEYMEVSRRANKAVARIVQSHQQTGRSGSRREKVREQSHAKTGTVDNNTSTDLKSLRPDELPHPEVEDLAQINPFWGQSPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idazoxan hydrochloride
MBS3605992-01 5 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
Idazoxan hydrochloride
MBS3605992-02 10 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
Idazoxan hydrochloride
MBS3605992-03 5x 10 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
RPS12P13 siRNA Oligos set (Human)
42057171 3x 5 nmol

RPS12P13 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit anti-human pleckstrin homology-like domain, family A, member 2 polyclonal Antibody
MBS714571-01 0.1 mL

Rabbit anti-human pleckstrin homology-like domain, family A, member 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human pleckstrin homology-like domain, family A, member 2 polyclonal Antibody
MBS714571-02 5x 0.1 mL

Rabbit anti-human pleckstrin homology-like domain, family A, member 2 polyclonal Antibody

Sign In for Pricing
View Details