Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Mouse (224a.a, HEK293, His)

The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Mouse (224a.a, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-mouse-224a-a-hek293-his.html

Purity

95.0

Smiles

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Molecular Formula

16149 (Gene_ID) P04441-1 (Q56-L279) (Accession)

Molecular Weight

40-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL
BNC470841-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF740 conjugate, 0.1mg/mL
BNC740521-100 1x 100 µL

AFP (Alpha Fetoprotein) (MBS-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details