Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin regulatory light chain 12A (MYL12A)

Product Specifications

Product Name Alternative

Epididymis secretory protein Li 24; HEL-S-24; MLC-2B; Myosin RLC; Myosin regulatory light chain 2, nonsarcomeric; Myosin regulatory light chain MRLC3

Abbreviation

Recombinant Human MYL12A protein

Gene Name

MYL12A

UniProt

P19105

Expression Region

1-171aa

Organism

Homo sapiens (Human)

Target Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Secretory Immunoglobulin A (sIgA) ELISA Kit
EKU08429 96 Tests

Pig Secretory Immunoglobulin A (sIgA) ELISA Kit

Sign In for Pricing
View Details
NCF4 antibody - C-terminal region
MBS3214111-01 0.1 mL

NCF4 antibody - C-terminal region

Sign In for Pricing
View Details
NCF4 antibody - C-terminal region
MBS3214111-02 5x 0.1 mL

NCF4 antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Hexokinase 1 HK1 ELISA Kit
BG-MUS11210 1 Each

Mouse Hexokinase 1 HK1 ELISA Kit

Sign In for Pricing
View Details
Mouse Ikbke Antibody (Center) Blocking Peptide
MBS9220644-01 0.5 mg

Mouse Ikbke Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Mouse Ikbke Antibody (Center) Blocking Peptide
MBS9220644-02 5x 0.5 mg

Mouse Ikbke Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details