Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Felis catus (Cat) Creatine kinase (CKM), partial

Product Specifications

Abbreviation

Recombinant Cat CKM protein, partial

Gene Name

CKM

UniProt

M3VYX8

Expression Region

179-424aa

Organism

Felis catus (Cat) (Felis silvestris catus)

Target Sequence

SIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Tag

Tag-Free

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.4 kDa

References & Citations

"Initial sequence and comparative analysis of the cat genome." Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. O'Brien S.J. Genome Res. 17:1675-1689 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1389982-01 0.02 mg (E-Coli)

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1389982-02 0.02 mg (Yeast)

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1389982-03 0.1 mg (E-Coli)

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1389982-04 0.1 mg (Yeast)

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1389982-05 0.02 mg (Baculovirus)

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details
Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)
MBS1389982-06 0.02 mg (Mammalian-Cell)

Recombinant Frankia alni Spermidine/putrescine import ATP-binding protein PotA (potA)

Sign In for Pricing
View Details