Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Elastin (Eln), partial

Product Specifications

Product Name Alternative

Tropoelastin

Abbreviation

Recombinant Mouse Eln protein, partial

Gene Name

Eln

UniProt

P54320

Expression Region

266-443aa

Organism

Mus musculus (Mouse)

Target Sequence

PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

References & Citations

"Elastin is an essential determinant of arterial morphogenesis." Li D.Y., Brooke B., Davis E.C., Mecham R.P., Sorensen L.K., Boak B.B., Eichwald E., Keating M.T. Nature 393:276-280 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 Mouse mAb, Cy3 conjugated
orb2892668 100 µL

CD31 Mouse mAb, Cy3 conjugated

Sign In for Pricing
View Details
Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)
MBS2102511-01 5x 96 Tests

Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)
MBS2102511-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)
MBS2102511-03 10x 96 Tests

Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)
MBS2102511-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Myosin IB (MYO1B) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
PRDX3 Antibody, Biotin conjugated
MBS7048922-01 0.05 mg

PRDX3 Antibody, Biotin conjugated

Sign In for Pricing
View Details